PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05805.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 316aa    MW: 35366.5 Da    PI: 6.1446
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05805.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.3e-11191237551
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                              kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  ++  
  Rsa1.0_05805.1_g00001.1 191 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPRIAF 237
                              899*********************************98888777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-14187251IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.599189241IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-13191242No hitNo description
SuperFamilySSF579591.69E-11191245No hitNo description
PfamPF001708.1E-10191236IPR004827Basic-leucine zipper domain
CDDcd147035.87E-24192242No hitNo description
PROSITE patternPS000360194209IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTTTTTPHWP EFSSQKLPSI AATAAATAGQ QNPSWMDEFL DFSSTRRGTD RRSISDSIAF  60
LDQPSSGVGS HHFDRFDDEQ FMSMFNDDLH QNHHHNNSVN GNVGHTRSSS NTSTPSDQNS  120
LLSGEDNKEQ PPSDNDHMDT TTANDNNVAG NNYNESDEVQ SHCCKTEPQD GPSSTNQDSG  180
KSSGNRIHDP KRVKRILANR QSAQRSRVRK LQYISELERS VTSLQTEVSV LSPRIAFLDH  240
QRLLLNVDNS AIKQQIAALA QDKIFKDAHQ EALKREIERL QQVYHQQSLK KMVDNISDQS  300
LADIKPSVEK EQLLSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010427719.11e-177PREDICTED: basic leucine zipper 61
SwissprotQ9M2K41e-170BZP61_ARATH; Basic leucine zipper 61
TrEMBLM4CT381e-176M4CT38_BRARP; Uncharacterized protein
STRINGBra007380.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-159bZIP family protein